PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna02652.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 278aa    MW: 30674.4 Da    PI: 5.8872
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna02652.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.96.2e-151462148
                             TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                             +g W++eEde l+ + + +G+g +W   +++ g++R++k+c++rw++yl
  mrna02652.1-v1.0-hybrid 14 KGQWSPEEDEALKTYLETHGSGgNWIHLPQKAGLRRCGKSCRLRWLNYL 62
                             799********************************************97 PP

2Myb_DNA-binding51.23e-1669111246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g +T+eEd ++ ++ +q+G++ W+ Ia+ m+ gRt++++k++w++
  mrna02652.1-v1.0-hybrid  69 GHFTEEEDNIICNLYTQMGSR-WSYIAAQMP-GRTDNDVKNYWNT 111
                              679******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.04962IPR017930Myb domain
SuperFamilySSF466891.52E-2711109IPR009057Homeodomain-like
SMARTSM007171.4E-101364IPR001005SANT/Myb domain
PfamPF002496.5E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-231569IPR009057Homeodomain-like
CDDcd001671.34E-81762No hitNo description
PROSITE profilePS5129422.78563117IPR017930Myb domain
SMARTSM007172.1E-1267115IPR001005SANT/Myb domain
PfamPF002491.2E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-2570116IPR009057Homeodomain-like
CDDcd001674.61E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGQWSPE EDEALKTYLE THGSGGNWIH LPQKAGLRRC GKSCRLRWLN  60
YLRPDIKHGH FTEEEDNIIC NLYTQMGSRW SYIAAQMPGR TDNDVKNYWN TKLKKKYFLP  120
AKPSLTAKES KNPNASPLTL PCAPKLETSD EFQTQIHPTL MVSDSNSGLD AYDQCLSLNP  180
NPLYNSQLMG FSQFGATSVS MSQDGSSVSD SSSIAAVDNG LLHGNNFINE DAAGISMDFG  240
FGGLPYDVVN QMWFGEKASE VVHPTCSTSL DADFFFC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-22141167107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285421e-165FR828542.1 Rosa rugosa mRNA for putative MYB transcription factor (myb9 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011458889.11e-173PREDICTED: LOW QUALITY PROTEIN: transcription factor RAX1-like
TrEMBLF2QKW21e-138F2QKW2_R
STRINGPOPTR_0006s25060.18e-83(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.12e-70myb domain protein 68